PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6357_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 336aa    MW: 37250.4 Da    PI: 8.5945
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6357_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.5e-4126102278
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          C v+gC+adls+++eyhrrhkvCe hsk+++v++ g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk
  cra_locus_6357_iso_5_len_1660_ver_3  26 CLVDGCNADLSQCREYHRRHKVCELHSKTAKVTIGGREQRFCQQCSRFHSLAEFDEGKRSCRKRLDGHNRRRRK 99 
                                          ************************************************************************** PP

                                          --- CS
                                  SBP  76 kqa 78 
                                          +q+
  cra_locus_6357_iso_5_len_1660_ver_3 100 PQP 102
                                          997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-332187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.06923100IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-3824104IPR004333Transcription factor, SBP-box
PfamPF031101.1E-302699IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MESSASLSGS SKRAKALGSI SQVAHCLVDG CNADLSQCRE YHRRHKVCEL HSKTAKVTIG  60
GREQRFCQQC SRFHSLAEFD EGKRSCRKRL DGHNRRRRKP QPELSRNSGL LFSSPQGTRL  120
LSFSPPQIFP SAVVSSTWTA AVKPENDVVL FNNQSNLNYV DRQNSFPESS SSVHSYKGVN  180
RFQFMQVTDN NHLPEASICQ PLLDPNARSG HTNSGQKMFS DGLNQVIHSD RALSLLSSAT  240
AVTREIGFSP MVQQQQQPES IPPTAQQSLA HHSHSLHYGS PGQFPFAPEL ENNKPVVSET  300
QSQVSSNATL HFQEMFQTGP DESSTSGSHQ TLTFLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2826991184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18299KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764317.11e-146PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_009764316.11e-146PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_009764315.11e-146PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_009764314.11e-146PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA0A068UYH81e-167A0A068UYH8_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000563731e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037